Uji Toksisitas Akut Ekstrak Etil Asetat Daun Garcinia benthami Pierre dengan Metode Braine Shrimp Lethality Test (BSLT)

UJI TOKSISITAS AKUT EKSTRAK ETIL ASETAT
DAUN Garcinia benthami Pierre DENGAN METODE
BRINE SHRIMP LETHALITY TEST (BSLT)

Laporan Penelitian ini ditulis sebagai salah satu syarat untuk memperoleh gelar
SARJANA KEDOKTERAN

OLEH :
Nurraisya Mutiyani
NIM: 1110103000088

PROGRAM STUDI PENDIDIKAN DOKTER
FAKULTAS KEDOKTERAN DAN ILMU KESEHATAN
UNIVERSITAS ISLAM NEGERI
SYARIF HIDAYATULLAH
JAKARTA
1434 H/ 2013 M

ii

iii

iv

KATA PENGANTAR

Alhamdulillah, puji dan syukur sebanyak-banyaknya penulis panjatkan
kepada Allah SWT karena atas berkat dan rahmat-Nya, penulis dapat
menyelesaikan skripsi ini. Shalawat serta salam tiada henti penulis sampaikan
kepada suri teladan Rasulullah SAW. Penulis skripsi ini dilakukan dalam rangka
memenuhi salah satu sayarat untuk mencapai gelar Sarjana Kedokteran pada
Fakultas Kedokteran Universitas Islam Negeri Syarif Hidayatullah. Penulis
menyadari bahwa tanpa seizin Allah, bantuan dan bimbingan dari berbagai pihak,
dari masa perkuliahan sampai pada penyusunan skripsi ini, sangatlah sulit untuk
menyelesaikan skripsi ini. Oleh karena itu penulis mengucapkan terima kasih
kepada:
1. Prof. Dr (hc). dr. M.K Tadjudin, SpAnd, dr. M. Djauhari Widjajakusumah,
DR. Arif Sumantri, S.KM, M.Kes, Dra. Farida Hamid, MA selaku Dekan
dan Pembantu Dekan FKIK UIN Syarif Hidayatullah Jakarta.
2. dr.Witri Ardini, M.Gizi, SpGK selaku Ketua Program Studi Pendidikan
Dokter atas bimbingan yang diberikan selama penulis menempuh
pendidikan di PSPD FKIK UIN Syarif Hidayatullah Jakarta ini.
3. Pembimbing I, dr.Nurul Hiedayati, PhD atas segala bantuannya yang telah
membimbing saya dengan baik dan sabar ditengah kesibukannya yang
sangat padat.
4. Pembimbing II, Ibu Puteri Amelia, M.Fam, Apt, yang telah sabar, baik,
dan teliti dalam membimbing, menasehati, dan menyemangati saya selama
ini.
5. drg. Laifa Annisa Hendarmin, Ph.D selaku penanggung jawab modul Riset
yang tidak pernah lelah selalu mengingatkan penulis untuk segera
menyelesaikan penelitian.
6. Ibunda tercinta Ratna Sari yang telah memberikan do’a, dukungan, dan
kasih sayang yang tidak pernah putus sampai dengan saat ini.

v

7. Ayahanda tercinta Hasyim Mahyudin yang selalu mendukung baik moral
maupun materiil dalam menempuh pendidikan dan selalu memberikan
nasihat hidup.
8. Keluarga tercinta, dr.Syahdi dan Bang Raedi, Skg serta keluarga lainnya
yang selalu memberikan do’a dan harapan selama ini.
9. Staf laboratorium PNA, Biologi, dan Farmako, Mas Rahmadi, Mba Rani,
dan Mba Suryani yang selalu siap direpotkan dan dimintai pertolongan dan
selama pengerjaan skripsi ini.
10. Kawan-kawan seperjuangan skripsi kelompok 1, Aulia Ajrina, Nur
Rizqillah, Ratu Quroatuain, Fitri Fatimatuzzahra, dan Eri Djuhairiyah.
11. Pak Supandi yang selalu siap dimintai pertolongan dan mahasiswa
Program Studi Farmasi 2009, Ka Agung, Ka Mila, Ka Nita, dll yang
membantu penelitian ini.
12. Seluruh mahasiswa PSPD UIN Syarif Hidayatullah 2010 yang berjuang
bersama untuk tujuan yang sama.
13. Semua pihak baik yang terlibat langsung maupun tidak langsung dalam
pembuatan skripsi ini. Semoga rahmat dan keselamatan selalu Allah
limpahkan kepada kita semua. Allahumma amin.
Akhir kata, penulis berharap Allah SWT berkenan membalas segala
kebaikan semua pihak yang telah membantu. Semoga skripsi ini membawa
manfaat bagi diri saya khususnya, pengembangan ilmu kedokteran dan
masyarakat pada umumnya.

vi

ABSTRAK
Nurraisya Mutiyani. Program Studi Pendidikan Dokter. Uji Toksisitas Akut
Ekstrak Etil Asetat Daun Garcinia benthami Pierre dengan Metode Braine Shrimp
Lethality Test (BSLT). 2013

Potensi toksik daun Garcinia benthami Pierre diketahui melalui uji toksisitas akut
dengan metode Braine Shrimp Lethality Test (BSLT). Tujuan penelitian ini adalah
untuk mengetahui nilai letal concentration (LC) atau kematian larva Artemia
salina Leach sebanyak 50% atau disebut LC50. Daun Garcinia benthami dari
Bogor diekstraksi dengan cara maserasi selama 2 hari dengan etil asetat. Uji
toksisitas ini menggunakan 5 konsentrasi yaitu 100 ppm, 50 ppm, 20 ppm, 10
ppm, dan 5 ppm. Ekstrak diteteskan sebanyak 1 ml kedalam 10 ekor larva yang
diberi 9 ml air laut. Selanjutnya observasi selama 24 jam dan hitung berapa
banyak kematian larva dalam setiap konsentrasi. Hasil penelitian menunjukkan
ekstrak etil asetat daun Garcinia benthami mempunyai LC50 99,78 ppm. Hasil
tersebut menunjukkan bahwa ekstrak daun Garcinia benthami bersifat toksik
karena nilai LC50 ≤ 1000 ppm. Hasil uji ini dapat dilanjutkan dengan penelitian
terhadap hewan trofis yang lebih tinggi dan penelitian berikutnya, yaitu uji
toksisitas subakut dan kronik sebagai obat anti kanker dimasa depan.
Kata Kunci: Toksisitas, Ekstrak daun Garcinia benthami Pierre, BSLT, Uji
toksisitas akut
ABSTRACT
Nurraisya Mutiyani. Medical education study program. Acute Toxicity Assay
Extract Etil Asetat of Garcinia benthami Pierre Leaves by Methode Brine Shrimp
Lethality Test (BSLT)
Potential toxic of leaves Garcinia benthami Pierre known through acute toxicity
test with the method Braine Shrimp Lethality Test (BSLT). The purpose of this
study was to determine the lethal concentration (LC) or Artemia salina Leach
larval mortality by 50% (LC50). Leaves of Garcinia benthami Bogor extracted by
maceration for 2 days with ethyl acetate. The toxicity tests using 5 concentrations
of 100 ppm, 50 ppm, 20 ppm, 10 ppm, and 5 ppm. Dropped as much as 1 ml of
the extract into 10 Artemia salina Leach larvae fed 9 ml of seawater. Further
observation for 24 hours and count how many larval mortality in each
concentration. The results showed the ethyl acetate extract of leaves of Garcinia
benthami have LC50 99,78 ppm. The results showed that leaves extract of Garcinia
benthami leaves are toxic because the value of LC50 ≤ 1000 ppm. The test results
can be followed by animal studies trofis higher and subsequent research, the
subacute and chronic toxicity test as an anti-cancer drug in the future.
Keyword: Toxicity, leaves Extract of Garcinia benthami Pierre, BSLT, Acute
toxicity assay

vii

DAFTAR ISI

LEMBAR JUDUL ..........................................................................................
LEMBAR PERNYATAAN ............................................................................
LEMBAR PERSETUJUAN ...........................................................................
LEMBAR PENGESAHAN ............................................................................
KATA PENGANTAR ....................................................................................
ABSTRAK .......................................................................................................
DAFTAR ISI ...................................................................................................
DAFTAR TABEL ...........................................................................................
DAFTAR GAMBAR ......................................................................................
BAB I PENDAHULUAN
1.1 Latar belakang ..................................................................................
1.2 Rumusan masalah .............................................................................
1.3 Tujuan penelitian ..............................................................................
1.3.1 Tujuan umum ..........................................................................
1.3.2 Tujuan khusus .........................................................................
1.4 Manfaat penelitian ............................................................................
1.4.1 Bagi masyarakat.......................................................................
1.4.2 Bagi institusi............................................................................
1.4.3 Bagi peneliti ...........................................................................
BAB II TINJAUAN PUSTAKA
2.1 Landasan teori ..................................................................................
2.1.1 Tanaman obat...........................................................................
2.1.2 Genus Garcinia........................................................................
2.1.3 Garcinia benthami Pierre........................................................
2.1.4 Kandungan kimia genus Garcinia ...........................................
2.1.5 Ekstraksi dan maserasi.............................................................
2.1.6 Efek toksik suatu zat................................................................
2.1.7 Uji toksisitas............................................................................
2.1.7.1 Tingkatan uji toksisitas...................................................
2.1.7.2 Uji toksisitas akut...........................................................
2.1.7.3 Metode BSLT.................................................................
2.1.8 Pemilihan hewan uji............................................................
2.1.8.1 Pemilihan hewan uji.......................................................
2.1.8.2 Artemia salina Leach.....................................................
2.1.8.3 Morfologi.......................................................................
2.1.8.4 Siklus hidup...................................................................
2.1.8.5 Penetasan larva...............................................................
2.2 Kerangka konsep ..............................................................................
2.3 Definisi operasional ..........................................................................

viii

I
ii
iii
iv
v
vii
vii
i
x

1
1
3
3
3
3
4
4
4
4
5
5
6
7
9
10
11
12
12
13
14
16
16
17
17
20
21
23
24

BAB III METODE PENELITIAN
1.1 Desain penelitian ............................................................................
1.2 Waktu dan tempat penelitian ..........................................................
1.3 Populasi dan sampel........................................................................
1.3.1 Populasi..................................................................................
1.3.2 Besar populasi........................................................................
1.3.3 Kriteria inklusi.......................................................................
1.3.4 Kriteria eksklusi.....................................................................
1.3.5 Cara pengambilan populasi....................................................
1.3.6 Sampel....................................................................................
1.4 Alat dan bahan............................................................................
3.4.1. Alat....................................................................................
3.4.2 Bahan..................................................................................
3.5 Cara kerja penelitian........................................................................
3.5.1 Penyiapan bahan........................................................................
3.5.2 Pembuatan ekstrak.....................................................................
3.5.3 Penyiapan larva..........................................................................
3.5.5 Pembagian konsentrasi...............................................................
3.5.6 Pelaksanaan uji toksisitas...........................................................
3.5.7 Alur penelitian.............................................................................
3.6 Manajemen data................................................................................

25
25
25
25
25
26
26
26
26
27
27
27
27
27
28
29
29
29
30
34

BAB IV HASIL DAN PEMBAHASAN
4.1 Penyiapan bahan.............................................................................
4.2 Ekstraksi..........................................................................................
4.3 Penentuan nilai LC50......................................................................

37
37
39

BAB V SIMPULAN DAN SARAN
5.1 Simpulan ...........................................................................................
5.2 Saran ..................................................................................................

42
42

DAFTAR PUSTAKA ......................................................................................
LAMPIRAN .....................................................................................................

43
46

ix

DAFTAR TABEL

Tabel 2.1 Kategori toksisitas bahan...............................................................
Tabel 4.1 Data rendemen ekstrak etil asetat daun Garcinia benthami..........
Tabel 4.2 Besar konsentrasi dan persentase kematian..................................
Tabel 4.3 Nilai Log C dan Probit setiap konsentrasi.....................................
Tabel 6.1 Data perumusan probit sederhana................................................
Tabel 6.2 Uji normalitas kolmogorov-smirnov.............................................

x

24
39
40
33
44
45

DAFTAR GAMBAR

Gambar 2.1 Daun Garcinia benthami Pierre.....................................................
Gambar 2.2 Artemia salina Leach.....................................................................
Gambar 2.3 Larva Artemia................................................................................
Gambar 2.4 Artemia dewasa jantan dan betina..................................................
Gambar 2.5 Siklus Hidup Artemia.....................................................................
Gambar 3.1 Bagan Alur Ekstraksi Daun Garcinia benthami Pierre..................
Gambar 3.2 Bagan Penyiapan larva Artemia salina Leach................................
Gambar 3.3 Pelaksanaan Uji Toksisitas.............................................................
Grafik 4.1 Probit Kematian dari Setiap Konsentrasi Ekstrak..........................
Gambar 4.4 Konsentrasi 1000 ppm....................................................................
Gambar 6.1 Hasil determinasi............................................................................
Gambar 6.2 Daun Garcinia benthami Pierre.....................................................
Gambar 6.3 Maserasi dengan etil asetat.............................................................
Gambar 6.4 Filtrat hasil maserasi.......................................................................
Gambar 6.5 Destilasi dengan rotary evaporator...............................................
Gambar 6.6 Ekstrak etil asetat 9,63 gr...............................................................
Gambar 6.7 Ekstrak kental etil asetat................................................................
Gambar 6.8 Ekstrak etil asetat akan ditimbang.................................................
Gambar 6.9 Neraca analitik...............................................................................
Gambar 6.10 Telur Artemia salina Leach..........................................................
Gambar 6.11 Wadah penetasan udang...............................................................
Gambar 6.12 Larutan induk esktrak...................................................................
Gambar 6.13 Pelaksanaan uji toksisitas.............................................................
Gambar 6.16 Kaleng telur Artemia salina Leach..............................................
Gambar 6.17 Kaleng telur Artemia salina Leach tampak depan....................

xi

7
17
18
19
20
31
32
33
42
43
46
53
53
53
53
54
54
54
54
55
55
55
55
56
56

BAB 1
PENDAHULUAN

1.1 Latar Belakang
Saat ini, hampir seluruh negara industri di dunia, terjadi peningkatan
popularitas dan penggunaan obat tradisional sebagai pendamping pengobatan
primer yang diberikan dokter, terutama di negeri Asia, Afrika, dan Amerika latin.
Menurut World Health Organization (WHO), bahkan di Afrika penggunaannya
mencapai 80%. Faktor yang mendorong negara-negara tersebut menggunakan
obat tradisional antara lain usia harapan hidup yang lebih panjang pada saat
prevalensi penyakit kronik meningkat, adanya kegagalan penggunaan obat
modern untuk penyakit tertentu diantaranya kanker serta semakin luas akses
informasi mengenai obat herbal di seluruh dunia. 1
Sedangkan di Indonesia, sejak dimulainya masa peradaban masyarakat
disana sudah menggunakan tanaman sebagai pengobatan dan pencegahan
penyakit, salah satu alasan karena banyaknya beragam spesies tumbuhan yang
dimiliki oleh Indonesia.2
Tetapi menurut WHO, obat tradisional yang digunakan belum banyak
penelitian yang membuktikan mengenai keamanan dan keampuhannya. Bahkan
karena sedikitnya informasi mengenai indikasi, jumlah dosis yang tepat, ataupun
kandungan toksik yang diatur dengan baik akan memberikan efek negatif bagi
penggunanya.1
Walaupun begitu, WHO tetap merekomendasikan penggunaan obat
tradisional dalam pengobatan berbagai penyakit terutama untuk penyakit kronis,
degeneratif, kanker, atau pemeliharaan kesehatan. WHO juga berharap semakin
banyak penelitian mengenai keamanan dan khasiat obat tradisional dari berbagai
macam spesies tumbuhan di dunia.1

1

2

Salah satu tanaman yang jumlahnya cukup banyak di Indonesia, dengan
jumlah mencapai 100 spesies adalah Garcinia benthami Pierre.3 Tanaman ini
masih berhubungan dekat dengan tanaman manggis karena memiliki genus yang
sama. Namun sayangnya, Garcinia benthami Pierre tidak sepopuler tanaman
manggis, salah satu alasannya karena tanaman ini lebih banyak dijumpai di hutan
tropis pulau kalimantan dan tidak banyak tumbuh di lingkungan warga. Selain itu,
karena maraknya penebangan liar di hutan-hutan Indonesia, Garcinia benthami
Pierre berisiko mengalami kepunahan sebelum dimanfaatkan dengan baik oleh
masyarakat Indonesia. Padahal berdasarkan penelitian uji aktivitas antioksidan
daun Garcinia benthami Pierre yang dilakukan di Universitas Indonesia, telah
dilaporkan terdapat berbagai macam kandungan senyawa kimia yang berfungsi
sebagai antioksidan, diantaranya adalah golongan xanton, kumarin, flavonoida,
dan terpenoid.4
Dengan adanya penelitian yang membuktikan bahwa didalam ekstrak daun
Garcinia benthami Pierre terdapat kandungan antioksidan, maka tanaman ini
sangat berpotensi sebagai obat herbal dan tidak menutup kemungkinan dapat
menjadi obat antikanker. Suatu senyawa yang memiliki aktivitas antitumor dan
antikanker berkorelasi dengan tingginya kandungan toksik dalam senyawa
tersebut.5
Sesuai dengan Permenkes No.760/Menkes/per/IX/1992 mengenai regulasi
obat herbal yang berisi: sebelum obat tradisional atau fitofarmaka dikatakan aman
dikonsumsi, maka setiap bahan alam harus melewati beberapa tahapan meliputi
uji toksisitas akut, uji toksisitas subakut, uji toksisitas kronik, uji farmakologi
eksperimental, uji klinis, uji kualitas, dan uji lainnya. 5 Berdasarkan hal tersebut,
karena belum ada penelitian mengenai aktivitas toksik didalam Garcinia benthami
Pierre, maka dilakukanlah penelitian mengenai kemananan dan toksisitas ekstrak
etil asetat daun Garcinia bentami Pierre menggunakan metode Brine Shrimp
Lethality Test (BSLT).
Metode BSLT dipilih karena merupakan salah satu uji toksisitas akut atau
tingkat pertama dengan menggunakan larva udang Artemia salina Leach sebagai
hewan uji. Parameter pada uji BSLT ini dengan melihat kematian dari larva

3

setelah 24 jam. Diharapkan senyawa yang bersifat toksik dalam Garcinia
benthami Pierre akan menghambat suplai nutrisi kedalam tubuh larva dan akan
menimbulkan kematian. Suatu tanaman dikatakan toksik jika terbukti dapat
mematikan larva udang Artemia salina Leach dengan nilai LC50 < 1000 ppm.6
1.2 Rumusan Masalah
Apakah didalam ekstrak etil asetat daun Garcinia benthami Pierre bersifat toksik
menurut metode BSLT?
1.3 Tujuan Penelitian
1.3.1 Tujuan umum
Membuktikan ada tidaknya potensi toksisitas pada ekstrak etil asetat daun
Garcinia benthami Pierre menurut metode BSLT.

1.3 Tujuan Khusus


Mengukur persentase kematian larva Artemia salina Leach setelah pemberian
ekstrak etil asetat daun Garcinia benthami Pierre.



Mengetahui nilai LC50 dari ekstrak etil asetat daun Garcinia benthami Pierre
dengan metode BSLT.

1.4 Manfaat Penelitian
1.4.1 Bagi Pembaca dan Masyarakat
Menambah informasi tentang tanaman keluarga manggis atau genus
Garcinia yang berpotensi sebagai tanaman obat.
1.4.2 Bagi Institusi
Memberikan tambahan pustaka karya ilmiah kepada Program Studi
Pendidikan Dokter (PSPD) maupun Fakultas Kedokteran dan Ilmu Kesehatan
(FKIK) Universitas Islam Negeri Syarif Hidayatullah Jakarta mengenai uji
toksisitas ekstrak etil asetat daun Garcinia benthami Pierre terhadap larva Artemia
salina Leach dengan metode BSLT.

4

1.4.3 Bagi Penulis


Mengaplikasikan ilmu dan metode penelitian tentang kesehatan masyarakat
dan menambah pengetahuan peneliti mengenai kemampuan menilai
keberbahayaan toksik daun Garcinia benthami Pierre.



Sebagai salah satu syarat mendapatkan gelar Sarjana Kedokteran di Fakultas
Kedokteran dan Ilmu Kesehatan Universitas Islam Negeri Syarif Hidayatullah
Jakarta.

BAB 2
TINJAUN PUSTAKA

2.1 Landasan Teori
2.1.1 Tanaman Obat
Sejak dimulainya masa peradaban, manusia sudah menggunakan tanaman
sebagai obat, yang awalnya tanaman digunakan sebagai sumber makanan atau
energi. Saat itu, antara satu generasi dengan generasi lainnya menggunakan
tanaman obat berdasarkan empiris atau informasi secara turun menurun.
Pernyataan ini diperkuat oleh seorang dokter berkebangsaan Perancis, Henri
Leclere (1870-1955) yang menulis dalam jurnal berjudul La Presse Medicale,
dimana tertulis bahwa sistem pengobatan dengan menggunakan tanaman sudah
dikenal sejak ribuan tahun silam, seperti pengobatan di China, Tibet, Ayuverda
dari India, suku-suku asli di Afrika, Amerika Utara dan Selatan. 2
Pada dasarnya, Allah SWT memang sudah menerangkan bahwa setiap
jenis tanaman memiliki manfaat masing-masing dan memberikan perintah kepada
umatnya untuk dapat memanfaatkan segala jenis tanaman secara maksimal, dalam
Al Quran surat Ar-Rad ayat 4"Dan di bumi ini terdapat bagian-bagian yang
berdampingan dan kebun-kebun anggur, tanam-tanaman dan pohon kurma yang
bercabang dan yang tidak bercabang, disirami dengan air yang sama. Kami
melebihkan sebagian tanaman-tanaman itu atas sebagian yang lain tentang
rasanya. Sesungguhnya pada yang demikian itu terdapat tanda-tanda (kebesaran
Allah) bagi kaum yang berfikir."
Penggunaan tanaman, bagian tanaman, atau sediaan yang terbuat dari
tanaman untuk pengobatan dan pencegahan penyakit dikenal dengan fitoterapi dan
tumbuhan yang digunakan disebut tumbuhan obat. Saat ini, penggunaan fitoterapi
sudah banyak digunakan dinegara Eropa dan Amerika. Di Jerman sendiri,
amandemen arzneimittelgesets (German Drug Act) yang diberlakukan mulai 1
Januari 1978 memutuskan bahwa ilmu pengobatan modern dan fitoterapi menjadi

5

6

bagian dalam sistem pengobatan. Hal ini menjadi salah satu kebangkitan fitoterapi
sehingga telah banyak peneliti yang melakukan pengujian terhadap tanaman obat
dari segi farmasetika, farmakologi, dan uji klinis. 2
Hal ini juga didukung dengan hasil survey nasional di Amerika Serikat
yang menyatakan bahwa orang dewasa yang melakukan terapi dengan obat herbal
dan mereka yang telah berkonsultasi dengan herbalis meningkat secara signifikan
selama periode 1990 - 1997. Banyak alasan terjadinya peningkatan penggunaan
obat herbal, yaitu persepsi bahwa produk dari alam selalu aman atau paling tidak
lebih aman dari obat modern sampai alasan yang lebih kompleks berkaitan dengan
kepercayaan agama.7
Penyebaran penggunaan obat herbal pada masyarakat umum harus
diperhatikan mengenai

mutu,

keamanan,

dan khasiat

obat

herbal

itu

sendiri.29Selain itu, obat herbal memiliki efek yang lebih lemah dibandingkan
dengan obat modern sehingga apabila diberikan kepada pasien harus
memperhatikan tingkat keparahan penyakit. Obat herbal tidak cocok untuk
penanganan gawat darurat karena memiliki waktu kerja obat yang relatif lebih
lama dibandingkan obat modern.7
Selama ini juga mitos bahwa obat tradional selalu aman banyak
dipromosikan oleh berbagai pihak. Padahal hal ini belum tentu benar karena tidak
ada obat yang efektif dan secara langsung bebas dari efek samping.
Ketidakamanan obat herbal dapat berasal dari dalam tanaman itu sendiri atau
berasal dari luar tanaman.7
Pemberian obat herbal sama seperti halnya obat modern, harus juga
menentukan faktor farmakologi (efek yang tidak diinginkan), kontroindikasi, dan
interaksi obat. Jenis obat herbalpun sangat beragam, mulai dari sedian jus sampai
dengan penggunaan teknik modern. Dalam membuat obat herbal juga harus
ditentukan kontrol kualitasnya dan yang bertanggung jawab pada kualitas akhir
produk adalah kualitas bahan baku yaitu faktor lingkungan tempat tumbuh seperti
iklim, cuaca, jenis tanah, waktu panen, serta proses produksi akan mempengaruhi
kandungan golongan atau senyawa aktif produk. 7

7

2.1.2Genus Garcinia
Garciniamerupakan salah satu kelompok flora yang hidup di wilayah
tropis dan pohon lapisan kedua (second storey) berdasarkan tingginya. Oleh
karena itu, biasa ditemukan dibawah naungan pohon-pohon yang lebih besar dan
sebagian besar Garcinia berbentuk pohon. Namun ada pula yang berbentuk pohon
kecil (shrub) misalnya Garcinia livingstonei Anders, dan Garcinia spicata
Hook.3Tanaman ini tersebar di beberapa negara Asia Tenggarayaitu di Thailand
118 jenis, malaysia 29 jenis, dan Filipina 6 jenis. Garcinia lebih banyak hidup di
daerah Kalimantan karena disana terdapat curah hujan yang merata serta iklim
yang memiliki kelembapan dan panas dan diperkirakan jumlahnya mencapai 100
spesies.8
Tanaman ini adalah tanaman perdu yang terdiri dari akar, batang, daun dan
bunga dapat mencapai ketinggian 30-35 meter, tetapi secara umum dapat tumbuh
7-25 meter. Ciri dari marga Garcinia ini memiliki bentuk batang lurus, mengecil
kearah ujung dan percabangan yang berselang-seling. Bentuk daunnya ada dua
macam, yaitu daun kelopak dan daun mahkota yang berjumlah 4-5 helai.Letak
bunganya berada di ketiak daun. Salah satu contoh Garcinia yang berbunga harum
namun baunya tidak terlalu tajam adalah Garcini celebica.3
Oleh masyarakat Indonesia biasanya dimanfaatkan sebagai tanaman buah,
pohon pinggir jalan, reboisasi, tanaman pencegah erosi karena akarnya dinilai
kuat menahan tanah, dan beberapa buahnya dapat dijadikan sumber makanan bagi
satwa liar.Tumbuhan Garcinia juga dimanfaatkan sebagai bahan bangunan karena
memiliki tekstur kayu yang keras dan bewarna mulai dari kuning sampai coklat
kemerahan.3
2.1.3 Garcinia Benthami Pierre
Garcinia benthamiPierre dalam sistematika (taksonomi) tumbuhan
diklasifikasikan sebagai berikut:8
Kingdom

: Plantae (tumbuh-tumbuhan)

Divisi

: Spermatophyta (tumbuhan berbiji)

8

Subdivisi

: Gngiospermae (berbiji tertutup)

Kelas

: Dicotyledonae( biji berkeping dua)

Ordo

: Guttifernales

Famili

: Guttiferae

Genus

: Garcinia

Spesies

: Garcinia benthami Pierre

Gambar 2.1 Daun Garcinia benthami pierre
(Sumber: data pribadi)

Gacinia benthami Pierre memiliki ciri: batang berbentuk lurus mengecil
kearah ujung dan berdiameter kurang lebih 10 meter. Bentuk pohon seperti
kerucut, memiliki percabangan selang seling dan tumbuh pada ketinggian 1-1000
diatas permukaan laut. Daun kelopak dan daun mahkota berjumlah 4-5 helai.3
Daun berbentuk tunggal, elips memanjang, ruas daun berhadapan atau
berbentuk helaian. Warna daun pada permukaan atas hijau gelap, sedangkan
permukaan bawah berwarna hijau terang, ukurannya 12-23 x 4,5-10 cm, tangkai
panjangnya 1,5-2 cm. Bunga betina terdapat pada ujung batang dengan susunan

9

menggarpu, garis tengah 5-6 cm.8Benang sari semu dengan tangkai-tangkai
sarinya yang bersatu menjadi sebuah cincin dibagian pangkal, atau menjadi 4-5
berkas pendek, bakal buah beruang 2-12, biasanya berbentuk papilla. Bunga
jantan memiliki benang sari dengan jumlah bervariasi, dan tangkai bersatu
menjadi satu tiang tengah atau membentuk 4-5 berkas, sedangkan ukurannya yang
lebih kecil dari betina.9
2.1.4 Kandungan Kimia GenusGarcinia
Terdapat beberapa kandungan kimia pada genus Garcinia, yaitu senyawa
xanton, bezofenon, golongan flavonoid, triterpen, dan asam organik. Golongan
xanton merupakan senyawa yang sebagian besar terdapat pada genus Garcinia
diantara jenis tanaman lainnya. Hampir semua xanton yang diketahui terdapat
pada empat suku: Guttiferae, Gentianaceae, Moraceae, dan Polygalaceae.9
Berdasarkan literatur yang ada, senyawa xanton pada marga ini, memiliki
aktivitas

sebagai

antioksidan,

antibakteri,

antimalaria,

antikanker,

dan

antiinflamasi. Senyawa xanton yang diisolasi dari genus Garcinia berasal dari
kulit

batang

kayu

Garciniatertrandra

Garcinialancilimba,Garciniarigida,

kulit

Pierre,
buah

kulit

batang

Garciniamangostana,

Garciniaparvifolia, dan buah dariGarciniaScortechinii. Selanjutnya senyawa
bezofenon juga ditemukan dari ekstrak metanol kulit buah kering Garciniaindica
yang mempunyai aktivitas antioksidan, yaitu mampu menekan hidroksil radikal
bebas dan antileukimia. Pada ekstrak metanol ranting dan daun Garciniabancana
terdapat aktivitas antibakteri Staphylococcusaureus.5
Golongan

flavonoid

yang

memiliki

aktivitas

antibakteri

dan

hepatoprotektif pada tikus berhasil diisolasi dari Garciniakola. Senyawa flavonoid
merupakan senyawa yang larut dalam air, dapat diekstraksi dengan etanol 70%
dan tetap ada dalam lapisan air setelah ekstrak ini dikocok dengan eter minyak
bumi.Senyawa terpenoid yang berhasil diisolasi dari Garciniahombroniana
memiliki bioaktivitas antiinflamasi dengan menghambat pembentukan bglukoronidase, histamin, dan lisozim. Senyawa ini umumnya larut dalam lemak
dan terdapat didalam sitoplasma tumbuhan dan biasanya terpenoid diektraksi dari
jaringan tumbuhan dengan memakai eter minyak bumi, eter atau kloroform, dan

10

dapat dipisahkan secara kromatorgafi pada silika gel atau alumina memakai
pelarut tersebut. Berdasarkan asil uji fitokimia atau golongan senyawa teradap
ekstrak kasar sampel, diperkirakan senyawa terpenoid dari bahan alam memiliki
khasiat sebagai senyawa toksik.10
Senyawa terakhir adalah asam organik, yaitu berupa asam mereolik dan
asam

morelik

dari

Garciniahanburyi

mempunyai

aktivitas

antibakteri

Staphylococcus aureus.5
2.1.5 Ekstraksi dan Maserasi
Ekstraksi adalah kegiatan pemisahan atau penarikan kandungan senyawa
organik suatu atau beberapa zat yang dapat larut dari suatu padatan atau cairan
dengan bantuan pelarut cair. Dengan cara ekstraksi ini, dapat memisahkan dua
atau lebih zat berdasarkan perbedaan kelarutan.Pemilihan pelarut dan cara
ekstraksi yang tepat dapat dilakukan dengan mengetahui senyawa aktif yang
dikandung simplisia.9
Definisi ekstrak sendiri adalah bahan hasil pengekstrakkan senyawa aktif
dari simplisia sesuai dengan pelarutnya lalu diuapkan dan serbuk yang sisa
diperlakukan

hal

yang

sama

sampai

memenuhi

standar

yang

telah

ditetapkan.Cairan pelarut adalah pelarut yang optimal untuk senyawa kandungan
yang aktif. Karena itulah ekstrak hanya mengandung sebagian besar senyawa
kandungan yang diinginkan karena senyawa tersebut dapat terpisahkan dari bahan
dan dari senyawa kandungan lainnya.10
Sedangkan definisi simplisia adalah bahan yang sudah dikeringkan,
biasanya bahan tersebut adalah bahan alami yang berasal dari tanaman dan
digunakan sebagai obat.Simplisia terdiri dari simplisia nabati (yang berasal dari
tumbuhan, baik tumbuhan utuh maupun sebagian), simplisia hewani, dan
simplisia mineral.11 Ada beberapa metode ekstraksi: destilasi uap, ekstraksi dengan
menggunakan pelarut, dan lainnya (Ekstraksi berkesinambungan, superkritikal
karbondioksida, ekstraksi ultrasonik,ekstraksi energi listrik). Ekstraksi dengan
menggunakan pelarut terdiri dari cara dingin dan panas.9

11

Cara dinginberupamaserasidanperkolasi. Cara maserasiadalah proses
ekstraksisimplisiamenggunakanperendamanpelarutdenganpengocokanataupengad
ukanpadatemperaturruangan.
Membranseldarisimplisiaakanpecahsehinggasenyawaaktif

yang

terdapatdidalamsimplisiaakankeluarakibatadanyaperbedaantekanan

yang

ditimbulkanpada

proses

maserasitersebut.

Setelahdilakukanmaserasi,

sisaserbukataumasasimplisianyadapatdipergunakankembalidenganmenambahkank
embalipelarutnya, carainidisebutremaserasi.9
Sedangkanperkolasimerupakanproses ekstraksi simplisia dengan selalu
menggunakan

pelarut

baru

dan

dilakukan

umumnya

pada

temperatur

ruangan.Dilakukan terus menerus sampai diperoleh ekstrak yang jumlahnya 1-5
kali
bahan.Selanjutnyamaserasimenggunakanpelarutdengancarapanasterdiridarirefluks
, soxhlet, digesti, infudasi, dandekoktasi. 11
2.1.6 Efek Toksik Suatu Zat
Efek toksik suatu zat perlu diketahui untuk dapat meningkatkan
kemampuan dalam menilai bahaya suatu zat dan melakukan tindakan pencegahan
serta pengobatan jika terjadi efek toksik atau keracunan. Bagaimana suatu zat
dapat berdampak toksik dipelajari dalam ilmu toksikologi. Dari beberapa literatur
didapat mengenai definisi dari toksikologi, yaitu ilmu yang mempelajari jejas atau
kerusakan/cedera pada organisme (hewan, tumbuhan, manusia), yang diakibatkan
oleh suatu materi, subtansi, dan atau alergi. Pada definisi lain menurut Borzelleca,
dl Ruchirawat, toksikologi adalah ilmu yang mempelajari secara kuantitatif dan
kualitatif pengaruh jelek dari zat kimiawi, fisis, dan biologis terhadap sistem
biologis. Suatu materi yang dapat menyebabkan kerusakan disebut racun atau
toksin.12&13
Jadi toksin dapat didefinisikan sebagai zat yang bila masuk kedalam tubuh
dalam dosis cukup, beraksi secara kimiawi sehingga menimbulkan kematian atau
kerusakan berat pada orang sehat.14 Efek toksik terjadi apabila dimulai adanya
interaksi biokimiawi antara zat toksik atau metabolit aktifnya dengan reseptor atau
bagian tertentu dari makhluk hidup, seperti enzim, protein, lemak, asam nukleat,
organel sel, membran sel, atau bahkan berupa jaringan. Interaksi biokimiawi yang

12

menyebabkan efek toksik lokal terjadi apabila zat kontak pertama kali terpapar
dengan bagian tubuh, sedangkan efek sistemik memiliki proses yang lebih
panjang diawali dengan absorpsi pada tempat kontak, lalu masuk sirkulasi tubuh
dan terdistribusi ke tempat sasaran sampai akhirnya menimbulkan efek. 15

Namun efek toksik yang ditimbulkan suatu zat dipengaruhi oleh banyak
faktor, yaitu faktor endogen dan faktor eksogen tergantung dari zat target,
mekanisme reaksi, dan besarnya dosis.15

2.1.7 Uji Toksisitas
2.1.7.1 Tingkatan Uji Toksisitas
Uji toksisitas adalah uji yang bertujuan untuk mencari dosis aman bagi
manusia, dapat dilakukan dengan dua cara, yaitu secara kualitatif dan kuantitatif.
Uji kualitatif dilakukan akibat dari tidak spesifiknya gejala atau penyakit akibat
suatu keracunan sehingga didasarkan kepada penyakit yang timbul. Sedangkan uji
kuantitatif dapat dilakukan melalui dua cara, yaitu uji toksistas dilaboratorium
terhadap hewan uji ataupun uji kuantitatif dalam penelitian epidemiologi.
Penelitian epidemiologi biasa dilakukan dengan menilai suatu peristiwa yang
terjadi pada kelompok manusia akibat keracunan suatu zat tertentu, seperti kasus
keracunan (Minamata, Itai-Itai), kondisi perang (bom nuklir di Hirosima dan
Nagasaki), dan sebagainya.16
Pada uji toksisitas dilaboratorium, dikenal istilah untuk menyatakan
toksistas suatu zat. Apabila kematian pada hewan uji sebagai respon terhadap zat
racun yang betul-betul masuk kedalam tubuh disebut dosis letal (LD). Apabila
kematian hewan uji akibat respon terhadap konsentrasi zat berada diluar tubuh
organisme uji disebut konsentrasi letal (LC). Uji toksisitas dilakukan berurutan
dengan melihat tingkat trofis organisme yaitu sesuai dengan rantai makanan
dilingkungan.15
Pada rantai makanan menggambarkan ukuran spesies yang umumnya
semakin besar dengan semakin tingginya posisi pada rantai makanan. Begitu pun
pada uji toksisitas, uji toksisitas tingkat I atau uji akut dilakukan pada hewan

13

derajat rendah dan semakin tinggi tingkat uji toksistas, semakin tinggi pula derajat
hewan uji.Berdasarkan waktu lamanya pajanan, penelitian toksikologi dibagi
menjadi tiga kategori: yaitu uji toksisitas akut, subakut, dan kronik. Uji toksisitas
jangka panjang adalah uji yang dilakukan dengan memberi zat uji secara
berulang-ulang selama minimal sebagian besar dari masa hidupnya. Misalnya 18
bulan untuk mencit, 24 bulan untuk tikus, dan 7-10 tahun untuk anjing dan
monyet.17
Uji toksisitas dilakukan untuk menilai efek akut, subakut, dan kronis. Uji
akut dilakukan dalam tahun pertama terhadap organisme berderajat rendah atau
kecil, dan dilanjutkan terhadap hewan yang berderajat lebih tinggi, dengan
meningkatnya waktu dan uji toksisitas lengkap akan memerlukan waktu selama
enam tahun.14&15
Uji toksisitas level I sering disebut sebagai uji jangka pendek atau short
term test(STT), dilakukan dalam tahun pertama. Uji toksisitas level II dilakukan
selama 2,5 tahun berikutnya dan Uji toksisitas level III atau level terakhir
biasanya dilakukan untuk menilai kemungkinan dampak pada manusia. 18
2.1.7.2 Uji Toksisitas Akut
Toksisitas akut adalah efek berbaya yang terjadi pada tubuh segera setelah
terpapar suatu zat, baik itu zat tunggal atau kombinasi (substances) sekali atau
beberapa kali dalam waktu yang singkat. Pada definisi lain dijelaskan efek
berbahaya terjadi dalam waktu 24 jam. Jumlah paparan maksudnya adalah jumlah
yang dapat membunuh atau untuk pembunuhan dan dapat mengancam jiwa. Efek
toksik yang ditimbulkan dapat berupa gangguan fungsional, biokimiawi, atau
fisiologis (struktural) yang dapat menyebabkan kesakitan yang mengganggu
kondisi tubuh secara umum.15
Uji toksisitas ini penting untuk evaluasi keamanan dan merupakan
prasyarat untuk uji klinik sebelum obat digunakan. Definisi dari uji toksisitas akut
adalah suatu metode untuk menentukan dosis letal median (LD 50, LC50),
mekanisme kerja, dan target organ dari suatu zat yang berpotensi memberikan
efek toksik. Sedangkan definisi LD50 atau LC50 adalah dosis atau konsentrasi yang

14

diberikan sekali (tunggal) atau beberapa kali dalam 24 jam dari suatu zat yang
secara statistik diharapkan dapat mematikan 50% hewan coba. Beberapa manfaat
lain dari uji toksisitas akut:15
1. Menentukan interval dosis untuk uji berikutnya, yaitu uji farmakologi,
toksistas subakut, subkronik, dan toksiistas jangka panjang
2. Untuk mengklasifikasikan zat uji
3. Mengidentifikasi kemungkinan target organ atau sistem fisiologi yang
dipengaruhi
4. Mengetahui hubungan antara dosis dengan timbulnya efek seperti perubahan
perilaku, koma, dan kematian
5. Mengetahui gejala-gejala toksisitas akut sehingga bermanfaat untuk
membantu diagnosis adanya kasus keracunan
6. Untuk memenuhi prasyarat regulasi, jika zat uji akan dikembangkan menjadi
obat
7. Mencari zat-zat potensial sebagai antikanker, karena jika suatu zat memiliki
LD50/LC50 kurang dari 100 mg/KgBB atau konsentrasi 1000 µg/mL zat ini
dianggap potensial sebagai sitotoksik
8. Untuk keperluan evaluasi bahaya suatu zat melalui data yang diperoleh
seperti nilai slope dari grafik hubungan antara log dosis versus respon
9. Mengetahui pengaruh umut, jenis kelamin, cara pemberian dan faktor
lingkungan hidup terhadap toksisitas suatu zat.15
2.1.7.3Metode BSLT
BSLT merupakan suatu bioassay yang pertama untuk penelitian bahan alam
dan salah satu metode menguji bahan-bahan yang bersifat toksik. Keunggulan dari
uji BSLT ini tidak menghabiskan banyak waktu, prosedurnya sederhana, cepat,
tidak membutuhkan banyak biaya, tidak membutuhkan teknik aseptik, tidak
memerlukan peralatan khusus dan hanya membutuhkan sedikit sampel uji.
Bioassay adalah uji yang menggunakan organisme hidup untuk mengetahui
efektifitas suatu bahan hidup ataupun bahan organik dan anorganik. Metode
BSLT menurut Meyer et al, McLaughlin & Rogers,et all,menggunakan larva
udang Artemia salina Leach sebagai hewan coba dan merupakan uji toksisitas

15

akut karena efek toksik dari suatu senyawa ditentukan dalam waktu singkat
(selama 24 jam) setelah pemberian dosis uji tunggal.Dasar pengujian dengan
metode BSLT pada kemampuan senyawa untuk mematikan larva udang.13
Caranya, yaitu dengan menentukan nilai LC50(letal concentration) dari
aktivitas komponen aktif tanaman terhadap larva Artemia Salina Leach. Tingkat
toksisitas suatu bahan dapat dilihat pada tabel 2.1.
Tabel 2.1 Kategori toksisitas bahan
Kategori

LC50 (µg/ml)

Sangat toksik

1000

Sumber: Meyer et al. (1982)19
Senyawa yang aktif akan menghasilkan mortalitas yang tinggi dan sesuai
acuan literatur tersebut dapat dilakukan uji berikutnya, seperti uji toksisitas
subakut, subkronis, atau toksisitas jangka panjang untuk dikembangkan sebagai
bahan baku obat, contohnya mencari zat-zat potensial sebagai antikanker.
Beberapa senyawa bioaktif yang telah berhasil diisolasi dan dimonitor
aktivitasnya dengan BSLT menunjukan adanya korelasi terhadap suatu uji
spesifik antikanker, yaitu pada harga LC50. Tetapi bila tidak bersifat toksik, dapat
diteliti kembali khasiat lainnya dengan menggunakan hewan coba lain yang lebih
besar dari larva Artemia salinaLeach, contonya mencit atau tikus secara in vivo
dan dapat dikembangkan untuk tujuan yang luas, seperti bahan baku kosmetika
atau suplemen makanan.20
Metode BSLT ini merupakan uji penapisan farmakologi awal yang
memiliki beberapa keunggulan, yaitu:
a. Relatif tidak mahal dan tidak membutuhkan keahlian tertentu
b. Metode ini juga telah teruji tingkat kepercayaannya sebesar 95% untuk
mengamati aktivitas toksik dalam suatu senyawa
c. Merupakan uji tahap awal isolasi senyawa-senyawa toksik yang terkandung
dalam ekstrak suatu tanaman

16

d. Metode ini juga dapat dikaitkan dengan metode penapisan untuk penyaringan
senyawa antikanker dari tanaman20

2.1.8 Hewan Uji
2.1.8.1 Pemilihan Hewan Uji
Hewan uji dipilih dalam penelitian toksisitas berdasarkan tingkat trofis masingmasing hewan uji pada piramida rantai makanan. Sesuai dengan kebutuhannya
maka penelitian toksisitas ini dapat dilakukan dengan menggunakan organisme
akuatik

air/tawar,

organisme

terestrial

atau

organisme

laut.

Beberapa

pertimbangan pemilihan larva udang sebagai hewan uji:
1. Telur Artemia: memiliki daya tahan yang lama (dapat tetap hidup dalam
kondisi kering, selama beberapa tahun), lebih cepat dan mudah menetas
dalam waktu 48 jam sehingga dapat dihasilkan dalam jumlah besar yang siap
untuk di uji.21
2. larva udang memiliki kemampuan untuk mengatasi perubahan tekanan
osmotik dan regulasi ion yang tinggi. 21
3. larva udang memiliki membran kulit yang tipis sehingga kematian suatu larva
akibat efek sitotoksik dari senyawa bioaktif dapat dianalogikan dengan
kematian sebuah sel dalam organisme.21
4. larva udang juga memiliki toleransi yang tinggi terhadap selang salinitas yang
luas, mulai dari air tawar hingga air yang bersifat jenuh garam. 22

2.1.8.2 Artemia salina Leach (Brine Shrimp)
Kingdom

: Animalia

Filum

: Arthropoda

Kelas

: Crustacea

Subkelas

: Branchiophoda

Ordo

: Anostraca

Famili

: Artemiidae

Genus

: Artemia

Spesies

: Artemia salina Leach.

17

Gambar 2.2. Artemia salina Leach (Brine Shrimp)
(sumber: aquafisher.org.ua)

Artemia merupakan hewan yang hidup di danau-danau garam (berair asin)
dan termasuk kelompok udang-udangan dari filum arthrophoda.hewan ini dapat
toleran hidup pada salinitas yang sangat luas, mulai dari nyaris tawar hingga jenuh
garam hal ini dikarenakan biasanya danau tempat Artemia hidup salinitasnya
sangat bervariasi tergantung pada jumlah hujan dan penguapan yang terjadi. Telur
Artemia lebih baik ditetaskan pada kadar garam lebih dari 25% karena dalam
kondisi tersebut telur berada dalam kondisi tersuspensi sedangkan kondisi telur
tidak bisa menetas dan tenggelam jika kadar garam kurang dari 6%. 23

2.1.8.3 Morfologi
Kista Artemia salina Leach setelah ditetaskan dalam waktu 24-48 jam
pada salinitas 15-35 ppt akan berubah menjadi larva yang dikenal dengan nama
Nauplius. Nauplius akan berubah betuk sebanyak 15 kali dan setiap satu fase
perubahan disebut instar. Nama lain untuk telur larva artemia adalah siste,
merupakan perkembangan lanjut dari embrio yang diselubungi cangkang yang
tebal dan kuat sehingga embrio lebih terlindungi dari pengaruh kekeringan,
benturan keras, sinar ultraviolet, dan mempermudah pengapungan.23

18

Gambar 2.3 : Larva artemia
(sumber: Panjaitan bontomi, R. 2011)24


Instar I: merupakan larva yang baru saja menetas. Warna tubuhnya
kemerahan akibat banyak mengandung makanan cadangan dan belum
perlu makan. Sudah memiliki anggota tubuh berupa antena kecil atau
antena I dan antena besar atau antena II yang terdapat sepasang rahang. 24



Instar II: yaitu setelah 24 jam menetas. Larva sudah memiliki mulut,
saluran pencernaan dan dubur karena itulah mulai mencari makanan dan
cadangan makanannya sudah mulai habis. Instar II memperoleh makanan
dengan menggerakkan antena II.24



Instar selanjutnya-XV: terbentuk sepasang mata majemuk, selain itu
berangsur-asngsur tumbuh tunas-tunas kakinya. Setelah menjadi instar
XV, kaki sudah lengkap sebanyak 11 pasang, dan mulailah menjadi larva
dewasa.24



Larva dewasa: artemia dewasa bentuknya telah sempurna dengan ukuran
panjang sekitar 1cm dengan kaki atau torakopoda sebanyak 11 pasang.
Pada jantan dan betina, antena I berfungsi sebagai alat peraba. Sedangkan
antena besar pada jantan menjadi alat penjepit yang besar dan berotot yang
kegunaannya

untuk

berpegangan

pada

betina

waktu

perkawinan. Pada betina, antena II mengalami penyusutan.

24

menjelang

19

Gambar 2.4 Artemia dewasa jantan dan betina
(sumberPanjaitan bontomi, R. 2011)24

Artemia digunakan sebagai hewan uji karena memiliki kesamaan
tanggapan

dengan

dengan

manusia,

yaitu

tipe

DNA-dependent

RNA

polimeraseartemia serupa dengan yang terdapat pada mamalia dan organisme
yang memiliki ouabaine-sensitive Na+ dan K+dependent ATPase. DNA-dependent
RNA polymerase merupakan DNA yang mengarahkan proses transksripsi RNA
yang bergantung pada RNA polymerase. Jika RNA polymerase itu dihambat,
maka DNA tidak dapat mensisntesis tidak dapat mensintesis RNA dan RNA tidak
dapat terbentuk sehingga sintesis protein juga dihambat. Jika protein tidka
terbentuk, metabolisme sel dapat terganggu sehingga dapat mengakibatkan
kematian sel.24
Artemia juga memiliki ouabaine-sensitive Na+ dan K+dependent ATPase.
Na+ dan K+dependent ATPase merupakan enzim yang mengkatalis hidrolisis ATP
menjadi ADP serta menggunakan energi untuk mengeluarkan 3Na+darisel dan
mengambil 2K+kedalam. Fungsi dari ouabaine adalah menghambat aktivitas
enzim tersebut dan menyebabkan keseimbangan ion Na+ dan K+tetap
terjaga.Suatu senyawa toksik pada ekstrak tanaman akan bekerja mengganggu
kerja salah satu enzim ini dan menyebabkan kematian artemia. 24

20

2.1.7.4Siklus Hidup

Gambar 2.5. Siklus Hidup Artemia
(sumber: Ambas, Zaldi. pakan alami: Artemia Klasifikasi Morfologi. 2010)
Siklus Artemi terdiri dari dua tahap. Tahap pertama dimulai saat
menetasnya telur atau kista. Selanjutnya akan menetas menjadi embrio (pada suhu
250C setelah 15-20 jam), tetapi masih dalam bentuk yang tidak sempurna karena
embrio ini masih menempel pada kulit kista, namun setelah beberapa jam
kemudian memasuki fase selanjutnya yaitu berubah menjadi nauplius yang
bewarna orange kecoklatan yang sudah dapat berenang bebas. Pada awalnya
nauplius masih tidak memiliki anus dan mulut sehingga pada tahap ini tidak dapat
makan. Lalu setelah 12 jam akan menetas dan berganti kulit, setelah itu memasuki
tahap larva kedua.23
Pada tahap ini, nauplius sudah dapat mengkonsumsi makanan berupa
mikro alga, bakteri, dan detritus organik lainnya. delapan hari kemudian berubah
menjadi dewasa dan selama masa itu berganti kulit sebanyak 15 kali. Artemia
dewasa menetaskan kista dan pertumbuhannya pada temperatur suhu 25 oC-30oC,
namun dapat toleran terhadap selang suhu -18oC – 40oC. Dapat hidup didalam air
tawar selama 5 jam sebelum akirnya mati. PH optimum adalah antara 8-9 karena
pH dibawah 5 atau diatas 10 dapat membunuh artemia. 23
Dalam fase ini mereka akan mulai makan dengan pakan berupa mikro alga,
bakteri, dan detritus organik lainnya. Nauplius akan berganti kulit sebanyak 15

21

kali sebelum menjadi dewasa dalam waktu 8 hari. Artemia dewasa rata-rata
berukuran 8 mm, meskipun demikian pada kondisi yang tepat mereka dapat
mencapai ukuran sampai dengan 20 mm. Artemia yang baik adalah yang bewarna
kuning atau merah jambu, dan untuk mencapai hal tersebut artemia diberikan
cahaya minimal yang diperlukan dalam proses penetasan dan akan sangat
menguntungkan bagi pertumbuhannya. Kadar oksigen juga harus dijaga dengan
baik untuk pertumbuhan artemia.17

2.1.8.5Penetasan Kista
Penentasan kista artemia dapat dilakukan dengan 2 cara, yaitu penetasan
langsung dan cara dekapsulasi. Cara dekapsulasi memang bukan cara yang umum,
namun memiliki keunggulan yaitu dapat meningkatkan daya tetas dan
menghilangkan penyakit yang dibawa oleh cystae artemia. Cara ini dilakukan
dengan mengupas bagian luar kista menggunakan larutan hipoklorit tanpa
mempengaruhi kelangsungan hidup embrio. 24
Beberapa syarat yang diperlukan agar kista Artemia salina dapat
ditetaskan secara optimal:


salinitas antara 20-30 ppt (parts per thousand) atau 1-2 sendok teh garam per
liter air tawar dan suhu air 26-28 °C



memberikan sinar lampu pada saat penetasan



aerasi yang cukup

Aerasi pada uji BSLT bertujuan untuk terjadinya perpindahan senyawa
sehingga terjadi kontak atara air dan udara. Dengan cara ini, proses aerasi dapat
meningkatkan jumlah O2 didalam air, menghilangkan CO2, H2S, dan
menghiangkan rasa serta bau yang disebabkan oleh zat-zat organik. Selain itu,
aerasi juga dapat meningkatkan pH dan menurunkan suhu termal air laut. alam 24
jam, larva udang membutuhkan proses aerasi dengan menggunakan aeratorselama
proses inkubasi. Aerasi bertujuan terjadi perpindahan senyawa yang bersifat
volatile dengan prinsip terjadinya kontak antara air dan udara sehingga Proses
aerasi dapat meningkatkan jumlah O2 didalam air, menghilangkan CO2, H2S dan
menghilangkan rasa serta bau yang disebabkan oleh zat-zat organik. Manfaat lain

22

dari aerasi juga dapat men

Dokumen yang terkait

Uji Toksisitas Ekstrak Tinta Cumi-Cumi (Photololigo Duvaucelii) Dengan Metode Brine Shrimp Lethality Test (Bslt)

20 174 104

Uji toksisitas akut ekstrak metanol daun laban abang (aglaia elliptica blume) terhadap larva udang (artemia salina leach) dengan metode Brine Shrimp Lethality Test (BSLT)

4 23 58

Uji Toksisitas Akut Ekstrak Etanol Daun Paku Pedang (Nephrolepis falcata) terhadap Larva Artemia Salina L dengan metode Brain Shirmp Lethaly Test (BSLT)

0 45 48

Uji Toksisitas Akut Ekstrak Metanol Daun Garcinia benthami Pierre Terhadap Larva Artemia salina Leach dengan Metode Brine Shrimp Lethality Test (BSLT)

2 29 75

Uji aktivitas Antimikroba Ekstrak Daun Garcinia benthami Pierre dengan Metode Dilusi

6 31 75

Uji Toksisitas Akut Ekstrak Etanol Daun Kemangi (Ocimum canum Sims) Terhadap Larva Artemia salina Leach dengan Metode Brine Shrimp Lethality Test (BSLT)

1 14 64

Uji Toksisitas Akut Ekstrak nheksan Daun Garcinia benthami Pierre Terhadap Larva Artemia salina Leach dengan Metode Brine Shrimp Lethality Test (BSLT)

0 5 63

Uji toksisitas akut ekstrak metanol daun annona muricata l terhadap larva artemia salina leach dengan metode Brine Shrimp Lethality Test (BSLT)

3 54 69

Uji Toksisitas Ekstrak Benalu Kopi (Loranthus ferrugineus Roxb.) dengan Metode Brine Shrimp Lethality Test (BSLT)

4 40 68

UJI TOKSISITAS FRAKSI DAUN MAJAPAHIT (Crescentia cujete L.) DENGAN MENGGUNAKAN METODE BRINE SHRIMP LETHALITY TEST (BSLT) JUDUL - Uji Toksisitas Fraksi Daun Majapahit (Crescentia cujete L.) dengan Menggunakan Metode Brine Shrimp Lethality Test (BSLT) - Rep

0 2 100

Dokumen baru

PENGARUH PENERAPAN MODEL DISKUSI TERHADAP KEMAMPUAN TES LISAN SISWA PADA MATA PELAJARAN ALQUR’AN HADIS DI MADRASAH TSANAWIYAH NEGERI TUNGGANGRI KALIDAWIR TULUNGAGUNG Institutional Repository of IAIN Tulungagung

119 3984 16

PENGARUH PENERAPAN MODEL DISKUSI TERHADAP KEMAMPUAN TES LISAN SISWA PADA MATA PELAJARAN ALQUR’AN HADIS DI MADRASAH TSANAWIYAH NEGERI TUNGGANGRI KALIDAWIR TULUNGAGUNG Institutional Repository of IAIN Tulungagung

40 1057 43

PENGARUH PENERAPAN MODEL DISKUSI TERHADAP KEMAMPUAN TES LISAN SISWA PADA MATA PELAJARAN ALQUR’AN HADIS DI MADRASAH TSANAWIYAH NEGERI TUNGGANGRI KALIDAWIR TULUNGAGUNG Institutional Repository of IAIN Tulungagung

40 945 23

PENGARUH PENERAPAN MODEL DISKUSI TERHADAP KEMAMPUAN TES LISAN SISWA PADA MATA PELAJARAN ALQUR’AN HADIS DI MADRASAH TSANAWIYAH NEGERI TUNGGANGRI KALIDAWIR TULUNGAGUNG Institutional Repository of IAIN Tulungagung

21 632 24

PENGARUH PENERAPAN MODEL DISKUSI TERHADAP KEMAMPUAN TES LISAN SISWA PADA MATA PELAJARAN ALQUR’AN HADIS DI MADRASAH TSANAWIYAH NEGERI TUNGGANGRI KALIDAWIR TULUNGAGUNG Institutional Repository of IAIN Tulungagung

28 790 23

KREATIVITAS GURU DALAM MENGGUNAKAN SUMBER BELAJAR UNTUK MENINGKATKAN KUALITAS PEMBELAJARAN PENDIDIKAN AGAMA ISLAM DI SMPN 2 NGANTRU TULUNGAGUNG Institutional Repository of IAIN Tulungagung

60 1348 14

KREATIVITAS GURU DALAM MENGGUNAKAN SUMBER BELAJAR UNTUK MENINGKATKAN KUALITAS PEMBELAJARAN PENDIDIKAN AGAMA ISLAM DI SMPN 2 NGANTRU TULUNGAGUNG Institutional Repository of IAIN Tulungagung

66 1253 50

KREATIVITAS GURU DALAM MENGGUNAKAN SUMBER BELAJAR UNTUK MENINGKATKAN KUALITAS PEMBELAJARAN PENDIDIKAN AGAMA ISLAM DI SMPN 2 NGANTRU TULUNGAGUNG Institutional Repository of IAIN Tulungagung

20 825 17

KREATIVITAS GURU DALAM MENGGUNAKAN SUMBER BELAJAR UNTUK MENINGKATKAN KUALITAS PEMBELAJARAN PENDIDIKAN AGAMA ISLAM DI SMPN 2 NGANTRU TULUNGAGUNG Institutional Repository of IAIN Tulungagung

32 1111 30

KREATIVITAS GURU DALAM MENGGUNAKAN SUMBER BELAJAR UNTUK MENINGKATKAN KUALITAS PEMBELAJARAN PENDIDIKAN AGAMA ISLAM DI SMPN 2 NGANTRU TULUNGAGUNG Institutional Repository of IAIN Tulungagung

41 1350 23